Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral ORF7 protein

This Viral ORF7 protein spans the amino acid sequence from region 1-123aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

V5N6H2

Expression Region

1-123aa

Tag

Tag-Free

Source

E.coli

Origin

Porcine reproductive and respiratory syndrome virus (PRRSV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-taggedExpression Region: 1-123aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPNNNGKQQKRKKGDGQPVNQLCQMLGKIITQQNQSRGKGPGKKNKKKNPEKPHFPLATEDDVRHHFTPSERQLCLSSIQTAFNQGAGTCTLSDSGRISYTVEFSLPTHHTVRLIRVTASPSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Presence - Absence Broth
74426-01 100 g

Presence - Absence Broth

Sign In for Pricing
View Details
Presence - Absence Broth
74426-02 500 g

Presence - Absence Broth

Sign In for Pricing
View Details
AP2M1 Antibody
OACA02818-100UG 100 µg

AP2M1 Antibody

Sign In for Pricing
View Details
Multiplex Eimeria mitis, brunetti, necatrix & praecox
MulOneq-A867-150D 150 Reactions

Multiplex Eimeria mitis, brunetti, necatrix & praecox

Sign In for Pricing
View Details
PPP1R1B 293 Cell Lysate
402736 0.1 mg

PPP1R1B 293 Cell Lysate

Sign In for Pricing
View Details
Rabbit Polyclonal Atlastin-3 Antibody [Alexa Fluor 405]
NBP2-97067AF405 0.1 mL

Rabbit Polyclonal Atlastin-3 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details