Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant Endochitinase protein

This Plant Endochitinase protein spans the amino acid sequence from region 1-200aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Endochitinase, EC 3.2.1.14, Fragments

UniProt

P86181

Expression Region

1-200aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Avena sativa (Oat)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-200aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VSSVISSSLFEKMLLHRGFYTYDAFIAAAKSFPAFATTGSTDVRKREVAAFLAQTSHETTGGWPTAPDGPYELGSTSDYFGRGPIQISYNYNYGAAGKAIGVDLLRNPDLVTSDNTVEFKTALWFWMTPQSPKPSSHDVITGRWSPSSTDKAAGRVPGYGVLTNIIDGGVECGKGQESHVADRIGYYKDNLDCYNQKPFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Chemokine C-C-Motif Receptor 7 (CCR7) ELISA Kit-Sandwich
EK5F680-01 48 Test

Mouse Chemokine C-C-Motif Receptor 7 (CCR7) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Mouse Chemokine C-C-Motif Receptor 7 (CCR7) ELISA Kit-Sandwich
EK5F680-02 96 Tests

Mouse Chemokine C-C-Motif Receptor 7 (CCR7) ELISA Kit-Sandwich

Sign In for Pricing
View Details
SMCP Rabbit Polyclonal Antibody (BF488)
orb2462840 100 µL

SMCP Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Anti-PCY1A antibody
STJ193012 200 µl

Anti-PCY1A antibody

Sign In for Pricing
View Details
Mouse Tet2 Pre-designed siRNA Set A
SI114463A 1 Each

Mouse Tet2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Atp1a2 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4583604 1.0 µg DNA

Atp1a2 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details