Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant Endochitinase protein

This Plant Endochitinase protein spans the amino acid sequence from region 1-200aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Endochitinase, EC 3.2.1.14, Fragments

UniProt

P86181

Expression Region

1-200aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Avena sativa (Oat)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-200aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VSSVISSSLFEKMLLHRGFYTYDAFIAAAKSFPAFATTGSTDVRKREVAAFLAQTSHETTGGWPTAPDGPYELGSTSDYFGRGPIQISYNYNYGAAGKAIGVDLLRNPDLVTSDNTVEFKTALWFWMTPQSPKPSSHDVITGRWSPSSTDKAAGRVPGYGVLTNIIDGGVECGKGQESHVADRIGYYKDNLDCYNQKPFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DECR2 Protein Lysate (Rat) with C-HA Tag
17872036 100 µg

DECR2 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
C19orf47 (NM_178830) Human Over-expression Lysate
E45H15668-2 20 µg

C19orf47 (NM_178830) Human Over-expression Lysate

Sign In for Pricing
View Details
Human MAPK11 Matched Antibody Pair Set [Poly/Poly] (Z01LS-1122-LS866)
Z01LS-1122-LS866 5 Plates

Human MAPK11 Matched Antibody Pair Set [Poly/Poly] (Z01LS-1122-LS866)

Sign In for Pricing
View Details
PLEKHA9 Antibody (C-term) Blocking Peptide
MBS9223254-01 0.5 mg

PLEKHA9 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
PLEKHA9 Antibody (C-term) Blocking Peptide
MBS9223254-02 5x 0.5 mg

PLEKHA9 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
FEZF1, NT (FEZF1, FEZ, ZNF312B, Fez family zinc finger protein 1, Zinc finger protein 312B) (PE)
MBS6298867-01 0.2 mL

FEZF1, NT (FEZF1, FEZ, ZNF312B, Fez family zinc finger protein 1, Zinc finger protein 312B) (PE)

Sign In for Pricing
View Details