Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant Endochitinase protein

This Plant Endochitinase protein spans the amino acid sequence from region 1-200aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Endochitinase, EC 3.2.1.14, Fragments

UniProt

P86181

Expression Region

1-200aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Avena sativa (Oat)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-200aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VSSVISSSLFEKMLLHRGFYTYDAFIAAAKSFPAFATTGSTDVRKREVAAFLAQTSHETTGGWPTAPDGPYELGSTSDYFGRGPIQISYNYNYGAAGKAIGVDLLRNPDLVTSDNTVEFKTALWFWMTPQSPKPSSHDVITGRWSPSSTDKAAGRVPGYGVLTNIIDGGVECGKGQESHVADRIGYYKDNLDCYNQKPFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant human Ubc9/UBE2I protein
UBC3001-020 20 µg

Recombinant human Ubc9/UBE2I protein

Sign In for Pricing
View Details
Isoquinolin-4-ylboronic acid, hydrochloride
OR908294-01 250 mg

Isoquinolin-4-ylboronic acid, hydrochloride

Sign In for Pricing
View Details
Isoquinolin-4-ylboronic acid, hydrochloride
OR908294-02 5 g

Isoquinolin-4-ylboronic acid, hydrochloride

Sign In for Pricing
View Details
Isoquinolin-4-ylboronic acid, hydrochloride
OR908294-03 25 g

Isoquinolin-4-ylboronic acid, hydrochloride

Sign In for Pricing
View Details
Isoquinolin-4-ylboronic acid, hydrochloride
OR908294-04 100 g

Isoquinolin-4-ylboronic acid, hydrochloride

Sign In for Pricing
View Details
Cytokeratin 4 Recombinant Antibody, Cy3 Conjugated
bsm-52062R-Cy3 100 µL

Cytokeratin 4 Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details