Bacterial BH0637 protein
This Bacterial BH0637 protein spans the amino acid sequence from region 1-328aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
BH0637, Putative adenine deaminase BH0637, Adenase, Adenine aminase, EC 3.5.4.2
UniProt
Q9KF49
Expression Region
1-328aa
Tag
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) (Bacillus halodurans)
Field of Research
Infectious Disease & Virology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
57.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-328aaSequence Info: Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MCEQKYRWTKKQIRQQLAVVRGEMAPTLVLKNATYLNSVRGKWLDANIWIYQDRIVYVGQDMPAKLDDETEVVDCGQQVIVPGYIEHHAHPFQLYNPHSFANYAAAMGTTTLINDNLMFFLALEKKKALSMIESLDELPSSMYWWCRYDPQTEMNDEEGHFLNSKIKEWLEHPLVVQGGELTSWPKVITGDDGILHWMQETRRLRKPIEGHFPGASEKTLTQMSLLGVTSDHEAMTGEEVIRRLDLGYMTSLRHSSIRSDLAKILREMKELGIDDFSRCMLTTDGSPPSFYEQGIMDRLIKIALDEGIPPKDAYGMATYYVARYYGLD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1146499-01 0.02 mg (E-Coli)
Recombinant Haemophilus somnus Acyl carrier protein (acpP)
Sign In for Pricing
View Details MBS1146499-02 0.1 mg (E-Coli)
Recombinant Haemophilus somnus Acyl carrier protein (acpP)
Sign In for Pricing
View Details MBS1146499-03 0.02 mg (Yeast)
Recombinant Haemophilus somnus Acyl carrier protein (acpP)
Sign In for Pricing
View Details MBS1146499-04 0.1 mg (Yeast)
Recombinant Haemophilus somnus Acyl carrier protein (acpP)
Sign In for Pricing
View Details MBS1146499-05 0.02 mg (Baculovirus)
Recombinant Haemophilus somnus Acyl carrier protein (acpP)
Sign In for Pricing
View Details MBS1146499-06 1 mg (E-Coli)
Recombinant Haemophilus somnus Acyl carrier protein (acpP)
Sign In for Pricing
View Details