Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial BH0637 protein

This Bacterial BH0637 protein spans the amino acid sequence from region 1-328aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BH0637, Putative adenine deaminase BH0637, Adenase, Adenine aminase, EC 3.5.4.2

UniProt

Q9KF49

Expression Region

1-328aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) (Bacillus halodurans)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-328aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MCEQKYRWTKKQIRQQLAVVRGEMAPTLVLKNATYLNSVRGKWLDANIWIYQDRIVYVGQDMPAKLDDETEVVDCGQQVIVPGYIEHHAHPFQLYNPHSFANYAAAMGTTTLINDNLMFFLALEKKKALSMIESLDELPSSMYWWCRYDPQTEMNDEEGHFLNSKIKEWLEHPLVVQGGELTSWPKVITGDDGILHWMQETRRLRKPIEGHFPGASEKTLTQMSLLGVTSDHEAMTGEEVIRRLDLGYMTSLRHSSIRSDLAKILREMKELGIDDFSRCMLTTDGSPPSFYEQGIMDRLIKIALDEGIPPKDAYGMATYYVARYYGLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Lysyl oxidase (LOX) ELISA Kit
YP-W60410-01 48 Tests

Chicken Lysyl oxidase (LOX) ELISA Kit

Sign In for Pricing
View Details
Chicken Lysyl oxidase (LOX) ELISA Kit
YP-W60410-02 96 Tests

Chicken Lysyl oxidase (LOX) ELISA Kit

Sign In for Pricing
View Details
Human Vitamin K1 (VK1) ELISA Kit
MBS9713721-01 48 Tests

Human Vitamin K1 (VK1) ELISA Kit

Sign In for Pricing
View Details
Human Vitamin K1 (VK1) ELISA Kit
MBS9713721-02 96 Tests

Human Vitamin K1 (VK1) ELISA Kit

Sign In for Pricing
View Details
Human Vitamin K1 (VK1) ELISA Kit
MBS9713721-03 5x 96 Tests

Human Vitamin K1 (VK1) ELISA Kit

Sign In for Pricing
View Details
Wolbachia wTpre PifA Rabbit Polyclonal Antibody (Fluoro594)
orb3087017 200 µL

Wolbachia wTpre PifA Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details