Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse PRL3D1 protein

This Mouse PRL3D1 protein spans the amino acid sequence from region 30-224aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chorionic somatomammotropin hormone 1 Placental lactogen I

UniProt

P18121

Expression Region

30-224aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 30-224aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SKPTAMVPTEDLYTRLAELLHNTFILAADVYREFDLDFFDKTWITDRTLPLCHTASIHTPENREEVHETKTEDLLKAMINVSISWKEPLKHLVSALTALPGASESMGKKAADIKGRNLVILEGLQTIYNRSQANIEENENFDYPAWSGLEELQSPNEDTHLFAVYNLCRCIKRDIHKIDSYIKVLRCRVVFQNEC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VWC2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2623807 1.0 µg DNA

VWC2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Phospho-Beta Catenin (Thr41 + Ser45) Rabbit Polyclonal Antibody (PE)
orb505054 100 µL

Phospho-Beta Catenin (Thr41 + Ser45) Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
RALYL-set siRNA/shRNA/RNAi Lentivector (Human)
38468091 4x 500 ng

RALYL-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
GPR34, ID (GPR34, Probable G-protein coupled receptor 34) (Biotin)
MBS6303911-01 0.2 mL

GPR34, ID (GPR34, Probable G-protein coupled receptor 34) (Biotin)

Sign In for Pricing
View Details
GPR34, ID (GPR34, Probable G-protein coupled receptor 34) (Biotin)
MBS6303911-02 5x 0.2 mL

GPR34, ID (GPR34, Probable G-protein coupled receptor 34) (Biotin)

Sign In for Pricing
View Details
OR4D2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1507108 1.0 µg DNA

OR4D2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details