Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse PRL3D1 protein

This Mouse PRL3D1 protein spans the amino acid sequence from region 30-224aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chorionic somatomammotropin hormone 1 Placental lactogen I

UniProt

P18121

Expression Region

30-224aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 30-224aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SKPTAMVPTEDLYTRLAELLHNTFILAADVYREFDLDFFDKTWITDRTLPLCHTASIHTPENREEVHETKTEDLLKAMINVSISWKEPLKHLVSALTALPGASESMGKKAADIKGRNLVILEGLQTIYNRSQANIEENENFDYPAWSGLEELQSPNEDTHLFAVYNLCRCIKRDIHKIDSYIKVLRCRVVFQNEC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIX4 (Sine Oculis Homeobox Homolog 4, Homeobox Protein SIX4, AREC3) (MaxLight 490)
133377-ML490 100 µL

SIX4 (Sine Oculis Homeobox Homolog 4, Homeobox Protein SIX4, AREC3) (MaxLight 490)

Sign In for Pricing
View Details
Plekhj1 ORF Vector (Mouse) (pORF)
36999014 1.0 µg DNA

Plekhj1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Rabbit anti-PLK2 Antibody
YLD6277-01 50 µL

Rabbit anti-PLK2 Antibody

Sign In for Pricing
View Details
Rabbit anti-PLK2 Antibody
YLD6277-02 100 µL

Rabbit anti-PLK2 Antibody

Sign In for Pricing
View Details
ATR, CT (Serine/Threonine-protein Kinase ATR, Ataxia Telangiectasia And Rad3-related Protein, FRAP-related Protein 1, FRP1) (Azide free) (HRP) discontinued
A4020-01J-HRP 200 µL

ATR, CT (Serine/Threonine-protein Kinase ATR, Ataxia Telangiectasia And Rad3-related Protein, FRAP-related Protein 1, FRP1) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Lilrb3l Rat shRNA Plasmid (Locus ID 361493)
TL703468 1 Kit

Lilrb3l Rat shRNA Plasmid (Locus ID 361493)

Sign In for Pricing
View Details