Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ATP5B protein

This Human ATP5B protein spans the amino acid sequence from region 230-529aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ATPMB, ATPSB

UniProt

P06576

Expression Region

230-529aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Disease Biomarkers

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 230-529aaSequence Info: Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Opiates (OPI) Rapid Test Midstream-Saliva
D-DOA3M20S 20 Tests

Opiates (OPI) Rapid Test Midstream-Saliva

Sign In for Pricing
View Details
CXCL5 (ENA-78, SCYB5) BioAssayTM ELISA Kit, Human
143798 96 Tests

CXCL5 (ENA-78, SCYB5) BioAssayTM ELISA Kit, Human

Sign In for Pricing
View Details
Annexin I discontinued
385838 200 µL

Annexin I discontinued

Sign In for Pricing
View Details
DOPEY1 Rabbit Polyclonal Antibody (BF350)
orb2514982 100 µL

DOPEY1 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana BAG family molecular chaperone regulator 3 (BAG3)
MBS1331407-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana BAG family molecular chaperone regulator 3 (BAG3)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana BAG family molecular chaperone regulator 3 (BAG3)
MBS1331407-02 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana BAG family molecular chaperone regulator 3 (BAG3)

Sign In for Pricing
View Details