Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KIR2DS3 protein

This Human KIR2DS3 protein spans the amino acid sequence from region 22-245aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MHC class I NK cell receptor Natural killer-associated transcript 7

UniProt

Q14952

Expression Region

22-245aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 22-245aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIK3CG Polyclonal Antibody
MBS8573041-01 0.1 mL

PIK3CG Polyclonal Antibody

Sign In for Pricing
View Details
PIK3CG Polyclonal Antibody
MBS8573041-02 0.1 mL (AF405L)

PIK3CG Polyclonal Antibody

Sign In for Pricing
View Details
PIK3CG Polyclonal Antibody
MBS8573041-03 0.1 mL (AF405S)

PIK3CG Polyclonal Antibody

Sign In for Pricing
View Details
PIK3CG Polyclonal Antibody
MBS8573041-04 0.1 mL (AF610)

PIK3CG Polyclonal Antibody

Sign In for Pricing
View Details
PIK3CG Polyclonal Antibody
MBS8573041-05 0.1 mL (AF635)

PIK3CG Polyclonal Antibody

Sign In for Pricing
View Details
PIK3CG Polyclonal Antibody
MBS8573041-06 0.1 mL (APC)

PIK3CG Polyclonal Antibody

Sign In for Pricing
View Details