E. coli ELTA protein
This E. coli ELTA protein spans the amino acid sequence from region 19-258aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
LT-A, porcine LTP-A
UniProt
P06717
Expression Region
19-258aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Escherichia coli
Field of Research
Infectious Disease & Virology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
32.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 19-258aaSequence Info: Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
NGDRLYRADSRPPDEIKRSGGLMPRGHNEYFDRGTQMNINLYDHARGTQTGFVRYDDGYVSTSLSLRSAHLAGQSILSGYSTYYIYVIATAPNMFNVNDVLGVYSPHPYEQEVSALGGIPYSQIYGWYRVNFGVIDERLHRNREYRDRYYRNLNIAPAEDGYRLAGFPPDHQAWREEPWIHHAPQGCGNSSRTITGDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRIRDEL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
036609-AP 200 µL
Histone H2B, NT (HIST1H2BC, H2BFL, HIST1H2BF, Histone H2B type 1-C/E/F/G/I, Histone H2B.1 A, Histone H2B.a, Histone H2B.g, Histone H2B.h, Histone H2B.k, Histone H2B.l) (AP) discontinued
Sign In for Pricing
View Details 
245274-PE 100 µL
DEAF1 (Deformed Epidermal Autoregulatory Factor 1 (Drosophila), NUDR, SPN, ZMYND5) (PE)
Sign In for Pricing
View Details orb2493171 100 µL
RNF109/TRIM56 Rabbit Polyclonal Antibody (APC-Cy7)
Sign In for Pricing
View Details MBS6309508-01 0.2 mL
IGHE, ID (IGHE, Ig epsilon chain C region) (AP)
Sign In for Pricing
View Details MBS6309508-02 5x 0.2 mL
IGHE, ID (IGHE, Ig epsilon chain C region) (AP)
Sign In for Pricing
View Details R1660-17-ML550 100 µL
Retinoblastoma Binding Protein 1 (RBP 1) (MaxLight 550) discontinued
Sign In for Pricing
View Details