E. coli ELTA protein
This E. coli ELTA protein spans the amino acid sequence from region 19-258aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
LT-A, porcine LTP-A
UniProt
P06717
Expression Region
19-258aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Escherichia coli
Field of Research
Infectious Disease & Virology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
32.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 19-258aaSequence Info: Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
NGDRLYRADSRPPDEIKRSGGLMPRGHNEYFDRGTQMNINLYDHARGTQTGFVRYDDGYVSTSLSLRSAHLAGQSILSGYSTYYIYVIATAPNMFNVNDVLGVYSPHPYEQEVSALGGIPYSQIYGWYRVNFGVIDERLHRNREYRDRYYRNLNIAPAEDGYRLAGFPPDHQAWREEPWIHHAPQGCGNSSRTITGDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRIRDEL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LS441871 100 µg
PRAMEF7 (NM_001012277) Human Over-expression Lysate
Sign In for Pricing
View Details MBS6371260-01 0.1 mL
BIRC2 (Baculoviral IAP Repeat-containing Protein 2, C-IAP1, IAP Homolog B, Inhibitor of Apoptosis Protein 2, IAP-2, hIAP-2, hIAP2, RING Finger Protein 48, TNFR2-TRAF-signaling Complex Protein 2, API1, IAP2, MIHB, RNF48) (MaxLight 405)
Sign In for Pricing
View Details MBS6371260-02 5x 0.1 mL
BIRC2 (Baculoviral IAP Repeat-containing Protein 2, C-IAP1, IAP Homolog B, Inhibitor of Apoptosis Protein 2, IAP-2, hIAP-2, hIAP2, RING Finger Protein 48, TNFR2-TRAF-signaling Complex Protein 2, API1, IAP2, MIHB, RNF48) (MaxLight 405)
Sign In for Pricing
View Details 