Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LOX protein

This Human LOX protein spans the amino acid sequence from region 169-417aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lysyl oxidase

UniProt

P28300

Expression Region

169-417aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 169-417aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NUDT19 Antibody Picoband®, iFluor647 Conjugate
A14864-1-iFluor647 100 µg

Anti-NUDT19 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
Human a-CTx  ELISA KIT
EF007252 96 Tests

Human a-CTx ELISA KIT

Sign In for Pricing
View Details
RPL29P16 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
41304061 1.0 µg DNA

RPL29P16 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
RPS2P15 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2000507 1.0 µg DNA

RPS2P15 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis 60 kDa chaperonin (groL), partial
MBS1165830 Inquire

Recombinant Staphylococcus epidermidis 60 kDa chaperonin (groL), partial

Sign In for Pricing
View Details
Dnaaf1 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7566702 1.0 µg DNA

Dnaaf1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details