Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LOX protein

This Human LOX protein spans the amino acid sequence from region 169-417aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lysyl oxidase

UniProt

P28300

Expression Region

169-417aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 169-417aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LOC100132146 knockout cell line
ABC-KH8548 1 Vial

Human LOC100132146 knockout cell line

Sign In for Pricing
View Details
AMOTL1 Protein Vector (Human) (pPB-His-GST)
PV321599 500 ng

AMOTL1 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
ARL13B (NM_182896) Human Recombinant Protein
TP321949L 1 mg

ARL13B (NM_182896) Human Recombinant Protein

Sign In for Pricing
View Details
2-Isopropoxyacetohydrazide
sc-298474 500 mg

2-Isopropoxyacetohydrazide

Sign In for Pricing
View Details
GMFG Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-13457R-BF594 100 µL

GMFG Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
P27Kip1 Antibody (Phospho-Ser140)
OAAB16422-400UL 400 µL

P27Kip1 Antibody (Phospho-Ser140)

Sign In for Pricing
View Details