Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse ANG4 protein

This Mouse ANG4 protein spans the amino acid sequence from region 25-144aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ang4Angiogenin-4, EC 3.1.27.-

UniProt

Q3TMQ6

Expression Region

25-144aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-sumostar-taggedExpression Region: 25-144aaSequence Info: Full Length of BC014667

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKRD36 Adenovirus (Human)
11993052 1.0 mL

ANKRD36 Adenovirus (Human)

Sign In for Pricing
View Details
Lentiviral human NXNL1 shRNA (UAS) - Lentiviral human NXNL1 shRNA (UAS, iRFP) (100)
GTR15122727 1 Vial

Lentiviral human NXNL1 shRNA (UAS) - Lentiviral human NXNL1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Research Grade Biciromab
DHB99201 100 μg

Research Grade Biciromab

Sign In for Pricing
View Details
Arp2 (ACTR2) (NM_005722) Human Untagged Clone
SC127153 10 µg

Arp2 (ACTR2) (NM_005722) Human Untagged Clone

Sign In for Pricing
View Details
ATIII Double Nickase Plasmid (m2)
sc-419222-NIC-2 20 µg

ATIII Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
CKAP4 Rabbit Polyclonal Antibody (Cy5)
orb887893 100 µL

CKAP4 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details