Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse ANG4 protein

This Mouse ANG4 protein spans the amino acid sequence from region 25-144aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ang4Angiogenin-4, EC 3.1.27.-

UniProt

Q3TMQ6

Expression Region

25-144aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-sumostar-taggedExpression Region: 25-144aaSequence Info: Full Length of BC014667

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclopenthiazide
TRC-C988420-25MG 25 mg

Cyclopenthiazide

Sign In for Pricing
View Details
EFNA2 antibody
10R-3940 100 ul

EFNA2 antibody

Sign In for Pricing
View Details
Anti-CHI3L1 Antibody Picoband® Fluoro550 Conjugated
A01283-1-Fluoro550 100 µg/Vial

Anti-CHI3L1 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Goat Mitochondrial import receptor subunit TOM70 (TOMM70A) ELISA Kit
GTR10362566 96 Well

Goat Mitochondrial import receptor subunit TOM70 (TOMM70A) ELISA Kit

Sign In for Pricing
View Details
Anti-Mouse VAChT antibody
STJ16101389 50 µl

Anti-Mouse VAChT antibody

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD106 Antibody
MBS4514740-01 20 Tests

PE/Cyanine7 Anti-Mouse CD106 Antibody

Sign In for Pricing
View Details