Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse ANG4 protein

This Mouse ANG4 protein spans the amino acid sequence from region 25-144aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ang4Angiogenin-4, EC 3.1.27.-

UniProt

Q3TMQ6

Expression Region

25-144aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-sumostar-taggedExpression Region: 25-144aaSequence Info: Full Length of BC014667

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

XRCC6 Rabbit Polyclonal Antibody
E53P12398 100 µL

XRCC6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Olr1104 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
33674156 3x 1.0 µg DNA

Olr1104 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Huntingtin Rabbit pAb
APA4294-01 30 µL

Huntingtin Rabbit pAb

Sign In for Pricing
View Details
Huntingtin Rabbit pAb
APA4294-02 50 μL

Huntingtin Rabbit pAb

Sign In for Pricing
View Details
Huntingtin Rabbit pAb
APA4294-03 100 µL

Huntingtin Rabbit pAb

Sign In for Pricing
View Details
IFN gamma Human rec.
P-2060020 20 µg

IFN gamma Human rec.

Sign In for Pricing
View Details