Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human COPS2 protein

This Human COPS2 protein spans the amino acid sequence from region 1-443aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alien homolog JAB1-containing signalosome subunit 2 Thyroid receptor-interacting protein 15

UniProt

P61201

Expression Region

1-443aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-taggedExpression Region: 1-443aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EF-Ts/TSFM/EF Rabbit Polyclonal Antibody (APC)
orb2591807 100 µg

EF-Ts/TSFM/EF Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
PCYT2 Human Over-expression Lysate
orb1359482 20 µg

PCYT2 Human Over-expression Lysate

Sign In for Pricing
View Details
STAG2 Rabbit Polyclonal Antibody
orb631552-01 50 µg

STAG2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STAG2 Rabbit Polyclonal Antibody
orb631552-02 100 µg

STAG2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Kv1.3 K+ Channel Antibody FL550 Conjugate
75-009-FL550 200 µL

Anti-Kv1.3 K+ Channel Antibody FL550 Conjugate

Sign In for Pricing
View Details
TRNAR34P 3'UTR GFP Stable Cell Line
TU077116 1.0 mL

TRNAR34P 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details