Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal Limulus clotting factor C protein

This Animal Limulus clotting factor C protein spans the amino acid sequence from region 763-1019aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Limulus clotting factor C, FC, EC 3.4.21.84) [Cleaved into, Limulus clotting factor C heavy chain, Limulus clotting factor C light chain, Limulus clotting factor C chain A, Limulus clotting factor C chain B]

UniProt

P28175

Expression Region

763-1019aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Tachypleus tridentatus (Japanese horseshoe crab)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 763-1019aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IWNGNSTEIGQWPWQAGISRWLADHNMWFLQCGGSLLNEKWIVTAAHCVTYSATAEIIDPSQFKIYLGKYYRDDSRDDDYVQVREALEIHVNPNYDPGNLNFDIALIQLKTPVTLTTRVQPICLPTDITTREHLKEGTLAVVTGWGLNENNTYSEMIQQAVLPVVAASTCEEGYKEADLPLTVTENMFCAGYKKGRYDACSGDSGGPLVFADDSRTERRWVLEGIVSWGSPSGCGKANQYGGFTKVNVFLSWIRQFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKAA1 Protein Lysate
OCOA12208-20UG 20 µg

PRKAA1 Protein Lysate

Sign In for Pricing
View Details
KIT (phospho-Y936) polyclonal antibody
BS64218-01 50 µL

KIT (phospho-Y936) polyclonal antibody

Sign In for Pricing
View Details
KIT (phospho-Y936) polyclonal antibody
BS64218-02 100 µL

KIT (phospho-Y936) polyclonal antibody

Sign In for Pricing
View Details
Rabbit Polyclonal NUDT16 Antibody
NBP2-37992-25ul 25 µL

Rabbit Polyclonal NUDT16 Antibody

Sign In for Pricing
View Details
Ehd2 Mouse shRNA Lentiviral Particle (Locus ID 259300)
TL508021V 500 µL Each

Ehd2 Mouse shRNA Lentiviral Particle (Locus ID 259300)

Sign In for Pricing
View Details
TNNI3 Antibody
orb571338-01 50 µg

TNNI3 Antibody

Sign In for Pricing
View Details