Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial CLPP2 protein

This Bacterial CLPP2 protein spans the amino acid sequence from region 1-198aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Endopeptidase Clp 2

UniProt

O51698

Expression Region

1-198aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-198aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTGKEDNDACVLHDKSLKLVLKSRSIVIAGEITKDVSRLFQEKILLLEALDFKKPIFVYIDSEGGDIDAGFAIFNMIRFVKPKVFTVGVGLVASAAALIFLAAKLENRFSLPFARYLLHQPLSGFKGVATDIEIYTNELNKVKKELNNIISKETGQKISKIEKDTDRDFWLDSSAAKKYGLVFEVVETKYQLEEFISA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC147 siRNA (h)
sc-90437 10 µM

CCDC147 siRNA (h)

Sign In for Pricing
View Details
Lentiviral mouse Rmi2 shRNA (UAS) - Lentiviral mouse Rmi2 shRNA (UAS, RFP) (25)
GTR15115679 1 Vial

Lentiviral mouse Rmi2 shRNA (UAS) - Lentiviral mouse Rmi2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Rat Monoclonal VCAM-1/CD106 Antibody (112734) [FITC]
FAB6432F 0.1 mL

Rat Monoclonal VCAM-1/CD106 Antibody (112734) [FITC]

Sign In for Pricing
View Details
CYP51A1, ID (Cytochrome P450-14DM, Cytochrome P45014DM, Sterol 14-alpha Demethylase, Cytochrome P450LI, CYPLI, Cytochrome P450 51A1, Lanosterol 14-alpha Demethylase, LDM, CYP51) (MaxLight 550) discontinued
C9095-51A-ML550 100 µL

CYP51A1, ID (Cytochrome P450-14DM, Cytochrome P45014DM, Sterol 14-alpha Demethylase, Cytochrome P450LI, CYPLI, Cytochrome P450 51A1, Lanosterol 14-alpha Demethylase, LDM, CYP51) (MaxLight 550) discontinued

Sign In for Pricing
View Details
KCTD12 Lentiviral Activation Particles (h2)
sc-406882-LAC-2 200 µL

KCTD12 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
C5orf54 Protein Vector (Human) (pPB-C-His)
PV006601 500 ng

C5orf54 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details