Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TERT protein

This Human TERT protein spans the amino acid sequence from region 281-436aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HEST2 Telomerase catalytic subunit Telomerase-associated protein 2

UniProt

O14746

Expression Region

281-436aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 281-436aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRLVETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVTPAAGVCAREKPQGSVA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-ROR gamma T antibody
SL23110R-01 50 µL

Rabbit Anti-ROR gamma T antibody

Sign In for Pricing
View Details
Rabbit Anti-ROR gamma T antibody
SL23110R-02 100 µL

Rabbit Anti-ROR gamma T antibody

Sign In for Pricing
View Details
PRP Rat peptide
orb216773-01 1 mg

PRP Rat peptide

Sign In for Pricing
View Details
PRP Rat peptide
orb216773-02 5 mg

PRP Rat peptide

Sign In for Pricing
View Details
PRP Rat peptide
orb216773-03 10 mg

PRP Rat peptide

Sign In for Pricing
View Details
Canine soluble Endoglin (sENG/sCD105) ELISA Kit
NSL0901Ca 96 Tests

Canine soluble Endoglin (sENG/sCD105) ELISA Kit

Sign In for Pricing
View Details