Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial FBPB protein

This Bacterial FBPB protein spans the amino acid sequence from region 41-325aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

30KDA extracellular protein Acyl-CoA, diacylglycerol acyltransferase Antigen 85 complex B

UniProt

P9WQP0

Expression Region

41-325aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 41-325aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITGAM Antibody
orb1178676 100 µg

ITGAM Antibody

Sign In for Pricing
View Details
Recombinant Populus alba Photosystem I assembly protein Ycf4 (ycf4)
orb2930060-01 20 µg

Recombinant Populus alba Photosystem I assembly protein Ycf4 (ycf4)

Sign In for Pricing
View Details
Recombinant Populus alba Photosystem I assembly protein Ycf4 (ycf4)
orb2930060-02 100 µg

Recombinant Populus alba Photosystem I assembly protein Ycf4 (ycf4)

Sign In for Pricing
View Details
Benzoylthiocholine iodide
orb2939085-01 100 mg

Benzoylthiocholine iodide

Sign In for Pricing
View Details
Benzoylthiocholine iodide
orb2939085-02 50 mg

Benzoylthiocholine iodide

Sign In for Pricing
View Details
Benzoylthiocholine iodide
orb2939085-03 250 mg

Benzoylthiocholine iodide

Sign In for Pricing
View Details