Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human S100A14 protein

This Human S100A14 protein spans the amino acid sequence from region 1-104aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

S100 calcium-binding protein A14

UniProt

Q9HCY8

Expression Region

1-104aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-sumostar-taggedExpression Region: 1-104aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDR2 (NM_001802) Human 3' UTR Clone
SC211937 10 µg

CDR2 (NM_001802) Human 3' UTR Clone

Sign In for Pricing
View Details
Human HLA Class II Histocompatibility Antigen, DM Beta Chain (HLA-DMB) ELISA Kit
abx387808 96 Well

Human HLA Class II Histocompatibility Antigen, DM Beta Chain (HLA-DMB) ELISA Kit

Sign In for Pricing
View Details
Human Carboxypeptidase E ELISA Kit
CEK2120 96 Tests

Human Carboxypeptidase E ELISA Kit

Sign In for Pricing
View Details
3,4-Dichloropentafluorobutyric Acid
FD82076-01 0.5 g

3,4-Dichloropentafluorobutyric Acid

Sign In for Pricing
View Details
3,4-Dichloropentafluorobutyric Acid
FD82076-02 1 g

3,4-Dichloropentafluorobutyric Acid

Sign In for Pricing
View Details
3,4-Dichloropentafluorobutyric Acid
FD82076-03 5 g

3,4-Dichloropentafluorobutyric Acid

Sign In for Pricing
View Details