Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rabbit ITGB8 protein

This Rabbit ITGB8 protein spans the amino acid sequence from region 146-384aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ITGB8Integrin beta-8

UniProt

P26013

Expression Region

146-384aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 146-384aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFERAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLRNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLF10 Polyclonal Antibody, Cy5.5 Conjugated
bs-21776R-Cy5.5 100 µL

KLF10 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Recombinant Desulfobacterium autotrophicum Adenylate kinase (adk)
MBS1034583-01 0.02 mg (E-Coli)

Recombinant Desulfobacterium autotrophicum Adenylate kinase (adk)

Sign In for Pricing
View Details
Recombinant Desulfobacterium autotrophicum Adenylate kinase (adk)
MBS1034583-02 0.1 mg (E-Coli)

Recombinant Desulfobacterium autotrophicum Adenylate kinase (adk)

Sign In for Pricing
View Details
Recombinant Desulfobacterium autotrophicum Adenylate kinase (adk)
MBS1034583-03 0.02 mg (Yeast)

Recombinant Desulfobacterium autotrophicum Adenylate kinase (adk)

Sign In for Pricing
View Details
Recombinant Desulfobacterium autotrophicum Adenylate kinase (adk)
MBS1034583-04 0.1 mg (Yeast)

Recombinant Desulfobacterium autotrophicum Adenylate kinase (adk)

Sign In for Pricing
View Details
Recombinant Desulfobacterium autotrophicum Adenylate kinase (adk)
MBS1034583-05 0.02 mg (Baculovirus)

Recombinant Desulfobacterium autotrophicum Adenylate kinase (adk)

Sign In for Pricing
View Details