Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rabbit ITGB8 protein

This Rabbit ITGB8 protein spans the amino acid sequence from region 146-384aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ITGB8Integrin beta-8

UniProt

P26013

Expression Region

146-384aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 146-384aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFERAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLRNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Geranylgeranyl transferase type 2 subunit Alpha ELISA kit
GTR10443568 96 Well

Rabbit Geranylgeranyl transferase type 2 subunit Alpha ELISA kit

Sign In for Pricing
View Details
Lentiviral mouse Sema3c shRNA (UAS) - Lentiviral mouse Sema3c shRNA (UAS, GFP) (100)
GTR15262905 1 Vial

Lentiviral mouse Sema3c shRNA (UAS) - Lentiviral mouse Sema3c shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
ADCY9 Antibody
35174-01 50 µL

ADCY9 Antibody

Sign In for Pricing
View Details
ADCY9 Antibody
35174-02 100 µL

ADCY9 Antibody

Sign In for Pricing
View Details
Rat Ube2ql1 Pre-designed siRNA Set B
SI215523B 1 Each

Rat Ube2ql1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Lentiviral human NDUFA5 shRNA (UAS) - Lentiviral human NDUFA5 shRNA (UAS, iRFP) (25)
GTR15148298 1 Vial

Lentiviral human NDUFA5 shRNA (UAS) - Lentiviral human NDUFA5 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details