Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rabbit ITGB8 protein

This Rabbit ITGB8 protein spans the amino acid sequence from region 146-384aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ITGB8Integrin beta-8

UniProt

P26013

Expression Region

146-384aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 146-384aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFERAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLRNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Renbp sgRNA CRISPR Lentivector set (Rat)
K7013801 3x 1.0 µg

Renbp sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Human SCNN1b ELISA Kit
orb442096-01 48 Tests

Human SCNN1b ELISA Kit

Sign In for Pricing
View Details
Human SCNN1b ELISA Kit
orb442096-02 96 Tests

Human SCNN1b ELISA Kit

Sign In for Pricing
View Details
CA5B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0347907 1.0 µg DNA

CA5B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
T-complex Protein 1 epsilon (T-complex Protein 1 epsilon Subunit, TCP1 epsilon, TCP1-epsilon, TCP-1 epsilon, Chaperonin Containing TCP1 epsilon, Chaperonin-containing TCP-1 epsilon, CCT epsilon, CCT-epsilon, CCTE, Chaperonin Containing TCP1 Subunit 5, Cha
MBS6250231-01 0.1 mL

T-complex Protein 1 epsilon (T-complex Protein 1 epsilon Subunit, TCP1 epsilon, TCP1-epsilon, TCP-1 epsilon, Chaperonin Containing TCP1 epsilon, Chaperonin-containing TCP-1 epsilon, CCT epsilon, CCT-epsilon, CCTE, Chaperonin Containing TCP1 Subunit 5, Cha

Sign In for Pricing
View Details
T-complex Protein 1 epsilon (T-complex Protein 1 epsilon Subunit, TCP1 epsilon, TCP1-epsilon, TCP-1 epsilon, Chaperonin Containing TCP1 epsilon, Chaperonin-containing TCP-1 epsilon, CCT epsilon, CCT-epsilon, CCTE, Chaperonin Containing TCP1 Subunit 5, Cha
MBS6250231-02 5x 0.1 mL

T-complex Protein 1 epsilon (T-complex Protein 1 epsilon Subunit, TCP1 epsilon, TCP1-epsilon, TCP-1 epsilon, Chaperonin Containing TCP1 epsilon, Chaperonin-containing TCP-1 epsilon, CCT epsilon, CCT-epsilon, CCTE, Chaperonin Containing TCP1 Subunit 5, Cha

Sign In for Pricing
View Details