Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse SULT1A1 protein

This Mouse SULT1A1 protein spans the amino acid sequence from region 1-291aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aryl sulfotransferase Phenol sulfotransferase Phenol/aryl sulfotransferase

UniProt

P52840

Expression Region

1-291aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-291aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEPLRKPLVPVKGIPLIKYFAETMEQLQNFTAWPDDVLISTYPKSGTNWMSEIMDMIYQGGKLDKCGRAPVYARIPFLEFSCPGVPPGLETLKETPAPRIIKTHLPLSLLPQSLLDQKIKVIYVARNAKDVVVSYYNFYKMAKLHPDPGTWESFLENFMDGKVSYGSWYQHVKEWWELRRTHPVLYLFYEDMKENPKREIKKILEFLGRSLPEETVDLIVHHTSFKKMKENPMANYTTIPTEVMDHTIYPFMRKGTIGDWKNTFTVAQSEHFDAHYAKLMTGCDFTFRCQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERK 5 Polyclonal Antibody
JOT-AP15460-01 20 µL

ERK 5 Polyclonal Antibody

Sign In for Pricing
View Details
ERK 5 Polyclonal Antibody
JOT-AP15460-02 50 μL

ERK 5 Polyclonal Antibody

Sign In for Pricing
View Details
ERK 5 Polyclonal Antibody
JOT-AP15460-03 100 µL

ERK 5 Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Htatip2 shRNA (UAS) - Lentiviral mouse Htatip2 shRNA (UAS, GFP) plasmid
GTR15255226 1 Vial

Lentiviral mouse Htatip2 shRNA (UAS) - Lentiviral mouse Htatip2 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
CYBASC3 CRISPRa sgRNA lentivector (set of three targets)(Human)
17246121 3x 1.0µg DNA

CYBASC3 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Klf10 (NM_031135) Rat Tagged Lenti ORF Clone
RR204826L4 10 µg

Klf10 (NM_031135) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details