Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse SULT1A1 protein

This Mouse SULT1A1 protein spans the amino acid sequence from region 1-291aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aryl sulfotransferase Phenol sulfotransferase Phenol/aryl sulfotransferase

UniProt

P52840

Expression Region

1-291aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-291aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEPLRKPLVPVKGIPLIKYFAETMEQLQNFTAWPDDVLISTYPKSGTNWMSEIMDMIYQGGKLDKCGRAPVYARIPFLEFSCPGVPPGLETLKETPAPRIIKTHLPLSLLPQSLLDQKIKVIYVARNAKDVVVSYYNFYKMAKLHPDPGTWESFLENFMDGKVSYGSWYQHVKEWWELRRTHPVLYLFYEDMKENPKREIKKILEFLGRSLPEETVDLIVHHTSFKKMKENPMANYTTIPTEVMDHTIYPFMRKGTIGDWKNTFTVAQSEHFDAHYAKLMTGCDFTFRCQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLCO1B1 Protein Lysate 20ug
IHUSLCO1B1PLLY20UG 20 µg

Human SLCO1B1 Protein Lysate 20ug

Sign In for Pricing
View Details
Fibroblast Growth Factor 1 (Acidic (FGF1) Human ELISA Kit
D4284 96 Tests

Fibroblast Growth Factor 1 (Acidic (FGF1) Human ELISA Kit

Sign In for Pricing
View Details
Recombinant Human ALDH3A1 Protein
E30P1235 20 µg

Recombinant Human ALDH3A1 Protein

Sign In for Pricing
View Details
Research Grade Ensituximab
HX246016-01 100 µg

Research Grade Ensituximab

Sign In for Pricing
View Details
Research Grade Ensituximab
HX246016-02 1 mg

Research Grade Ensituximab

Sign In for Pricing
View Details
PREPL Recombinant Antibody, Cy3 Conjugated
bsm-62950R-Cy3-TR 20 µL

PREPL Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details