Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi HFB2 protein

This Fungi HFB2 protein spans the amino acid sequence from region 16-86aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hydrophobin II

UniProt

P79073

Expression Region

16-86aa

Tag

N-terminal 10xHis-B2M-JD-tagged

Source

E.coli

Origin

Hypocrea jecorina (Trichoderma reesei)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-B2M-JD-taggedExpression Region: 16-86aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cavy Carbonyl Reductase 3 ELISA Kit
MBS091413 Inquire

Cavy Carbonyl Reductase 3 ELISA Kit

Sign In for Pricing
View Details
MUC2 Human siRNA Oligo Duplex (Locus ID 4583)
SR321038 1 Kit

MUC2 Human siRNA Oligo Duplex (Locus ID 4583)

Sign In for Pricing
View Details
Mouse Monoclonal HCV-NS3 Antibody (1B6) [DyLight 350]
NBP2-80122UV 0.1 mL

Mouse Monoclonal HCV-NS3 Antibody (1B6) [DyLight 350]

Sign In for Pricing
View Details
USO1 Antibody
E94236 100 µg

USO1 Antibody

Sign In for Pricing
View Details
Rat IgM (mu chain) Antibody Rhodamine Conjugated
orb347783 1 mg

Rat IgM (mu chain) Antibody Rhodamine Conjugated

Sign In for Pricing
View Details
Rabbit anti-Sheep Albumin Antibody
MBS3900487-01 2 mL

Rabbit anti-Sheep Albumin Antibody

Sign In for Pricing
View Details