Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi HFB2 protein

This Fungi HFB2 protein spans the amino acid sequence from region 16-86aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hydrophobin II

UniProt

P79073

Expression Region

16-86aa

Tag

N-terminal 10xHis-B2M-JD-tagged

Source

E.coli

Origin

Hypocrea jecorina (Trichoderma reesei)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-B2M-JD-taggedExpression Region: 16-86aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ovary: left
CS546842 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
Hepsin (HPN) (NM_002151) Human Recombinant Protein
TP761770 50 µg

Hepsin (HPN) (NM_002151) Human Recombinant Protein

Sign In for Pricing
View Details
Anti-Mouse-ear cress AtURI Antibody Fluoro550 Conjugated
DZ41764-Fluoro550 200 µL/Vial

Anti-Mouse-ear cress AtURI Antibody Fluoro550 Conjugated

Sign In for Pricing
View Details
KCNK17 AAV siRNA Pooled Vector
25397161 1.0 µg

KCNK17 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
ANT3310
MBS5786010 Inquire

ANT3310

Sign In for Pricing
View Details
4-Methylumbelliferyl 2-acetamido-3,4,6-tri-O-acetyl-2-deoxy-b-D-galactopyranoside
257720-01 100 mg

4-Methylumbelliferyl 2-acetamido-3,4,6-tri-O-acetyl-2-deoxy-b-D-galactopyranoside

Sign In for Pricing
View Details