Bacterial alpha-amylase inhibitor HOE-467A protein
This Bacterial alpha-amylase inhibitor HOE-467A protein spans the amino acid sequence from region 31-104aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Tendamistat
UniProt
P01092
Expression Region
31-104aa
Tag
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Streptomyces tendae
Field of Research
Infectious Disease & Virology; Pharmacology & Drug Discovery
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
28 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 31-104aaSequence Info: Extracellular Domain
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
DTTVSEPAPSCVTLYQSWRYSQADNGCAQTVTVKVVYEDDTEGLCYAVAPGQITTVGDGYIGSHGHARYLARCL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680977-500 1x 500 µL
TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680257-100 1x 100 µL
Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041045-500 1x 500 µL
CD16 (C16/1045), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680177-500 1x 500 µL
CD50 (ICAM-3) (101-1D2), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682853-500 1x 500 µL
CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details