Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IFNLR1 protein

This Human IFNLR1 protein spans the amino acid sequence from region 21-228aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytokine receptor class-II member 12 Cytokine receptor family 2 member 12

UniProt

Q8IU57

Expression Region

21-228aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-taggedExpression Region: 21-228aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RPRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEANWA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGDIG (Rho GDP-dissociation Inhibitor 3)
475558 100 µL

ARHGDIG (Rho GDP-dissociation Inhibitor 3)

Sign In for Pricing
View Details
APC/Cy7 Linked Polyclonal Antibody to Nitric Oxide Synthase 2, Inducible (NOS2)
MBS2107990-01 0.1 mL

APC/Cy7 Linked Polyclonal Antibody to Nitric Oxide Synthase 2, Inducible (NOS2)

Sign In for Pricing
View Details
APC/Cy7 Linked Polyclonal Antibody to Nitric Oxide Synthase 2, Inducible (NOS2)
MBS2107990-02 0.2 mL

APC/Cy7 Linked Polyclonal Antibody to Nitric Oxide Synthase 2, Inducible (NOS2)

Sign In for Pricing
View Details
APC/Cy7 Linked Polyclonal Antibody to Nitric Oxide Synthase 2, Inducible (NOS2)
MBS2107990-03 0.5 mL

APC/Cy7 Linked Polyclonal Antibody to Nitric Oxide Synthase 2, Inducible (NOS2)

Sign In for Pricing
View Details
APC/Cy7 Linked Polyclonal Antibody to Nitric Oxide Synthase 2, Inducible (NOS2)
MBS2107990-04 1 mL

APC/Cy7 Linked Polyclonal Antibody to Nitric Oxide Synthase 2, Inducible (NOS2)

Sign In for Pricing
View Details
APC/Cy7 Linked Polyclonal Antibody to Nitric Oxide Synthase 2, Inducible (NOS2)
MBS2107990-05 5 mL

APC/Cy7 Linked Polyclonal Antibody to Nitric Oxide Synthase 2, Inducible (NOS2)

Sign In for Pricing
View Details