Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CLU protein

This Human CLU protein spans the amino acid sequence from region 23-449aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aging-associated gene 4 protein Apolipoprotein J

UniProt

P10909

Expression Region

23-449aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

70.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 23-449aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTSH Antibody, HRP conjugated
MBS7047978-01 0.05 mg

CTSH Antibody, HRP conjugated

Sign In for Pricing
View Details
CTSH Antibody, HRP conjugated
MBS7047978-02 0.1 mg

CTSH Antibody, HRP conjugated

Sign In for Pricing
View Details
CTSH Antibody, HRP conjugated
MBS7047978-03 5x 0.1 mg

CTSH Antibody, HRP conjugated

Sign In for Pricing
View Details
Febantel
C10704-25mg 25 mg

Febantel

Sign In for Pricing
View Details
Human IgG1 (L234A/L235A/P329S), kappa Recombinant Isotype Control Antibody (HyHEL-10)
HV080017 100 µg

Human IgG1 (L234A/L235A/P329S), kappa Recombinant Isotype Control Antibody (HyHEL-10)

Sign In for Pricing
View Details
Mmu-miR-3105-5p miRNA Antagomir
orb1912920-01 10 nmol

Mmu-miR-3105-5p miRNA Antagomir

Sign In for Pricing
View Details