Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse ATP5B protein

This Mouse ATP5B protein spans the amino acid sequence from region 230-529aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Atp5f1b, Atp5b, ATP synthase subunit beta, mitochondrial, EC 7.1.2.2, ATP synthase F1 subunit beta

UniProt

P56480

Expression Region

230-529aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Disease Biomarkers

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 230-529aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGNEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Scavenger receptor class B member 1 (SCARB1) ELISA Kit
orb1948136-01 48 Tests

Rat Scavenger receptor class B member 1 (SCARB1) ELISA Kit

Sign In for Pricing
View Details
Rat Scavenger receptor class B member 1 (SCARB1) ELISA Kit
orb1948136-02 96 Tests

Rat Scavenger receptor class B member 1 (SCARB1) ELISA Kit

Sign In for Pricing
View Details
TXNDC11 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2544336 100 µL

TXNDC11 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
EIF4A1 Antibody
orb2808114 100 µL

EIF4A1 Antibody

Sign In for Pricing
View Details
KDM5B Human Over-expression Lysate
orb1357282 100 µg

KDM5B Human Over-expression Lysate

Sign In for Pricing
View Details
Hsa-miR-892c-5p miRNA Agomir
CMJ2033-01 5 nmol

Hsa-miR-892c-5p miRNA Agomir

Sign In for Pricing
View Details