Human WNT7B protein
This Human WNT7B protein spans the amino acid sequence from region 25-349aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Protein Wnt-7b, Wingless related MMTV integration site 7B, Wingless type MMTV integration site family member 7B, WNT, WNT7B, WNT7B_HUMAN
UniProt
P56706
Expression Region
25-349aa
Tag
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Stem Cell & Developmental Biology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
56.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 25-349aaSequence Info: Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
ALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1104085-01 0.02 mg (E-Coli)
Recombinant Hyperthermus butylicus Translation initiation factor 2 subunit alpha (eIF2A)
Sign In for Pricing
View Details MBS1104085-02 0.02 mg (Yeast)
Recombinant Hyperthermus butylicus Translation initiation factor 2 subunit alpha (eIF2A)
Sign In for Pricing
View Details MBS1104085-03 0.1 mg (E-Coli)
Recombinant Hyperthermus butylicus Translation initiation factor 2 subunit alpha (eIF2A)
Sign In for Pricing
View Details MBS1104085-04 0.1 mg (Yeast)
Recombinant Hyperthermus butylicus Translation initiation factor 2 subunit alpha (eIF2A)
Sign In for Pricing
View Details