Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial NADB protein

This Bacterial NADB protein spans the amino acid sequence from region 1-464aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Quinolinate synthase B

UniProt

O57765

Expression Region

1-464aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

71.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-464aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MMEMRVGIVGGGLAGLTAAIALAEKGFDVSIIGPRSTDSNSYLAQAGIALPLLEGDSIRIHVLDTIKAGKYINDEEIVWNVISKSSEAHDFLTSHGVTFTGNELEGGHSYPRIFTIKSETGKHIIPILEKHARELDVNFIRGFVEEIGINNGKLAGVFLQGELLKFDAVVIAAGGFSGLYRFTAGVKNNIGLLIGDVALKGVPLRDMEFVQFHPTGFIGKRTYLITEAVRGAGAKLVTGDGERFVNELETRDIVARAIYMKMLEGKGVFLDARGIENFKDRFPYIYSVLRGEGINPEKDLIPITPVAHYTIGGISVDAFYRTRIKGLYAIGESACNGFHGANRLASNSLLECVVSGLEVARTISREKPKREVNDAPYSFNELGDVDSIREVLWNHAGIVRDEWSLREGLRKLKEIEVDERLKLVAKAVIISALKREESRGAHYRKDYPFMRKEFEHSSFFYPNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey B cell antigen receptor complex associated protein β chain (CD79B) ELISA Kit
GTR10328870 96 Well

Monkey B cell antigen receptor complex associated protein β chain (CD79B) ELISA Kit

Sign In for Pricing
View Details
TS-152.40-514-S-YL-20 Die-cut & Printed Numbers & Letters
121804 20 Pack (20 Label (s) x 1 Pack)

TS-152.40-514-S-YL-20 Die-cut & Printed Numbers & Letters

Sign In for Pricing
View Details
CHO-PEG-SS, 10K
HE004028-10K Inquire

CHO-PEG-SS, 10K

Sign In for Pricing
View Details
ZNF608 Antibody
A16119-100UG 100 µg

ZNF608 Antibody

Sign In for Pricing
View Details
MEK7 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-61322R-BF647-01 20 µL

MEK7 Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
MEK7 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-61322R-BF647-02 100 µL

MEK7 Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details