Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial NADB protein

This Bacterial NADB protein spans the amino acid sequence from region 1-464aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Quinolinate synthase B

UniProt

O57765

Expression Region

1-464aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

71.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-464aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MMEMRVGIVGGGLAGLTAAIALAEKGFDVSIIGPRSTDSNSYLAQAGIALPLLEGDSIRIHVLDTIKAGKYINDEEIVWNVISKSSEAHDFLTSHGVTFTGNELEGGHSYPRIFTIKSETGKHIIPILEKHARELDVNFIRGFVEEIGINNGKLAGVFLQGELLKFDAVVIAAGGFSGLYRFTAGVKNNIGLLIGDVALKGVPLRDMEFVQFHPTGFIGKRTYLITEAVRGAGAKLVTGDGERFVNELETRDIVARAIYMKMLEGKGVFLDARGIENFKDRFPYIYSVLRGEGINPEKDLIPITPVAHYTIGGISVDAFYRTRIKGLYAIGESACNGFHGANRLASNSLLECVVSGLEVARTISREKPKREVNDAPYSFNELGDVDSIREVLWNHAGIVRDEWSLREGLRKLKEIEVDERLKLVAKAVIISALKREESRGAHYRKDYPFMRKEFEHSSFFYPNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SCP3/SYCP3 Antibody [Alexa Fluor 405]
NB300-232AF405 0.1 mL

Rabbit Polyclonal SCP3/SYCP3 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
HPS6 Antibody
DF15359-01 100 µL

HPS6 Antibody

Sign In for Pricing
View Details
HPS6 Antibody
DF15359-02 200 µL

HPS6 Antibody

Sign In for Pricing
View Details
SDCCAG3 Protein Vector (Mouse) (pPM-C-HA)
43241024 500 ng

SDCCAG3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human BRI3 (Brain protein I3) Full Length
MPC4584K Each

Magic™ Membrane Protein Human BRI3 (Brain protein I3) Full Length

Sign In for Pricing
View Details
Human Tumor Necrosis Factor a Receptor ELISA kit
GTR10379792 96 Well

Human Tumor Necrosis Factor a Receptor ELISA kit

Sign In for Pricing
View Details