Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect Venom allergen 5 protein

This Insect Venom allergen 5 protein spans the amino acid sequence from region 1-205aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Pol f V Antigen 5

UniProt

P35780

Expression Region

1-205aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Polistes fuscatus (Paper wasp)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-205aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKNNMQHHYLICNYGPAGNYLGQLPYTKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dihydroniloticin
HY-N3749 1 Each

Dihydroniloticin

Sign In for Pricing
View Details
GCK/GLK Polyclonal Antibody
46910-01 50 µL

GCK/GLK Polyclonal Antibody

Sign In for Pricing
View Details
GCK/GLK Polyclonal Antibody
46910-02 100 µL

GCK/GLK Polyclonal Antibody

Sign In for Pricing
View Details
C1orf112 Polyclonal Antibody
A67606-050 50 µL

C1orf112 Polyclonal Antibody

Sign In for Pricing
View Details
Cadherin 5 (CDH5) Antibody
abx413323 100 µg

Cadherin 5 (CDH5) Antibody

Sign In for Pricing
View Details
Lentiviral mouse Cdkn2aip shRNA (UAS) - Lentiviral mouse Cdkn2aip shRNA (UAS, iRFP) plasmid
GTR15215068 1 Vial

Lentiviral mouse Cdkn2aip shRNA (UAS) - Lentiviral mouse Cdkn2aip shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details