Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect Venom allergen 5 protein

This Insect Venom allergen 5 protein spans the amino acid sequence from region 1-205aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Pol f V Antigen 5

UniProt

P35780

Expression Region

1-205aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Polistes fuscatus (Paper wasp)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-205aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKNNMQHHYLICNYGPAGNYLGQLPYTKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti LHPP Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot,Immunofluorescence) 120ul
IRBAMLLHPPAP982120UL 120 µL

Rabbit Anti LHPP Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot,Immunofluorescence) 120ul

Sign In for Pricing
View Details
Egfl7 (NM_139104) Rat Tagged Lenti ORF Clone
RR210981L4 10 µg

Egfl7 (NM_139104) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PPP2CB Protein Lysate (Mouse) with C-HA Tag
37467034 100 µg

PPP2CB Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Recombinant Roseiflexus castenholzii Probable nicotinate-nucleotide adenylyltransferase (nadD)
MBS1263116-01 0.02 mg (E-Coli)

Recombinant Roseiflexus castenholzii Probable nicotinate-nucleotide adenylyltransferase (nadD)

Sign In for Pricing
View Details
Recombinant Roseiflexus castenholzii Probable nicotinate-nucleotide adenylyltransferase (nadD)
MBS1263116-02 0.1 mg (E-Coli)

Recombinant Roseiflexus castenholzii Probable nicotinate-nucleotide adenylyltransferase (nadD)

Sign In for Pricing
View Details
Recombinant Roseiflexus castenholzii Probable nicotinate-nucleotide adenylyltransferase (nadD)
MBS1263116-03 0.02 mg (Yeast)

Recombinant Roseiflexus castenholzii Probable nicotinate-nucleotide adenylyltransferase (nadD)

Sign In for Pricing
View Details