What is the catalog number for Bovine SFTPB protein?

The catalog number for Bovine SFTPB protein is orb419124.

What sizes are available for Bovine SFTPB protein?

Bovine SFTPB protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Bovine SFTPB protein come in?

Bovine SFTPB protein is available in 3 different pack sizes.

Is Bovine SFTPB protein in stock?

Bovine SFTPB protein is currently made to order / not held in immediate stock. Contact us for lead time.

Bovine SFTPB protein

This Bovine SFTPB protein spans the amino acid sequence from region 23-187aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

6KDA protein Pulmonary surfactant-associated proteolipid SPL (Phe)

UniProt

P15781

Expression Region

23-187aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 23-187aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAITYSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVEADDLCQECENISRLLTKMAKEAIFQDSVRKFLEQECDVLPLKLLAPLCRHLLDTYFPLIIEHFQSHMNPKFICQHVGLCKPRHPEPGKGPEPWGPLLDKLALPLLPGVPQAKPGPQTQDLSEQL