Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse ASGR2 protein

This Mouse ASGR2 protein spans the amino acid sequence from region 80-301aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hepatic lectin 2

UniProt

P24721

Expression Region

80-301aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 80-301aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEKRRNITH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIK3CA (E545G Mutant) Mouse mAb
orb2707427-01 50 µL

PIK3CA (E545G Mutant) Mouse mAb

Sign In for Pricing
View Details
PIK3CA (E545G Mutant) Mouse mAb
orb2707427-02 100 µL

PIK3CA (E545G Mutant) Mouse mAb

Sign In for Pricing
View Details
Leng1 3'UTR GFP Stable Cell Line
TU257014 1.0 mL

Leng1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
SOX4 Antibody
F47904-0.08ML 0.08 mL

SOX4 Antibody

Sign In for Pricing
View Details
Anti-FCGR2A Antibody Picoband®, Dylight550 Conjugate
A01450-1-Dylight550 100 µg

Anti-FCGR2A Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
AZD8529 mesylate
M11263-01 1 g

AZD8529 mesylate

Sign In for Pricing
View Details