Mouse ASGR2 protein
This Mouse ASGR2 protein spans the amino acid sequence from region 80-301aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Hepatic lectin 2
UniProt
P24721
Expression Region
80-301aa
Tag
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Field of Research
Signal Transduction
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
45.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 80-301aaSequence Info: Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
QSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEKRRNITH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
M01325-1 100 µL/Vial
Anti-Thrombomodulin THBD Rabbit Monoclonal Antibody
Sign In for Pricing
View Details 
GTR15308560 1 Vial
Lentiviral human ERMAP shRNA (UAS) - Lentiviral human ERMAP shRNA (UAS, RFP) plasmid
Sign In for Pricing
View Details 
MBS6230179-01 0.1 mL
SYT13 (Synaptotagmin XIII, KIAA1427) (MaxLight 650)
Sign In for Pricing
View Details MBS6230179-02 5x 0.1 mL
SYT13 (Synaptotagmin XIII, KIAA1427) (MaxLight 650)
Sign In for Pricing
View Details orb21388 1 mL
Goat Rat IgG2ab (subclass specific), conjugated with TRITC Antibody
Sign In for Pricing
View Details