Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant LEB6 protein

This Plant LEB6 protein spans the amino acid sequence from region 1-148aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Legumin type B acidic chain

UniProt

P16079

Expression Region

1-148aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Vicia faba (Broad bean) (Faba vulgaris)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-148aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GIPYWTYNNGDEPLVAISLLDTSNIANQLDSTPRVFYLGGNPEVEFPETQEEQQERHQQKHSLPVGRRGGQHQQEEDGNSVLSGFSSEFLAQTFNTEEDTAKRLRSPRDKRNQIVRVEGGLRIINPEGQQEEEEEEEEEKQRSEQGRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LHX8 Rabbit Polyclonal Antibody (FITC)
orb2130916 100 µL

LHX8 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
17-Hydroxypregnenolone (17a-OH-Pregnenolone) discontinued
H9111-28Y 1 mL

17-Hydroxypregnenolone (17a-OH-Pregnenolone) discontinued

Sign In for Pricing
View Details
HLA-G Knockout Hela Polyclonal Cells
ARG25797 1 Million

HLA-G Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
LOC128977 Protein Vector (Human) (pPB-C-His)
PV023965 500 ng

LOC128977 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Rat TNFR1/TNFRSF1A Protein (C-His, Rat)
P517975 100 µg

Rat TNFR1/TNFRSF1A Protein (C-His, Rat)

Sign In for Pricing
View Details
Lentiviral mouse Shld2 shRNA (UAS) - Lentiviral mouseShld2 shRNA (UAS, GFP) (25)
GTR15169364 1 Vial

Lentiviral mouse Shld2 shRNA (UAS) - Lentiviral mouseShld2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details