Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse IL18 protein

This Mouse IL18 protein spans the amino acid sequence from region 1-192aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon gamma-inducing factor

UniProt

P70380

Expression Region

1-192aa

Tag

Tag-Free

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-taggedExpression Region: 1-192aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

N- (5-amino-2-fluorophenyl) -N- (phenylsulfonyl) benzenesulfonamide
sc-354809 250 mg

N- (5-amino-2-fluorophenyl) -N- (phenylsulfonyl) benzenesulfonamide

Sign In for Pricing
View Details
Canine Connexin 40 ELISA Kit
MBS019218-01 48 Well

Canine Connexin 40 ELISA Kit

Sign In for Pricing
View Details
Canine Connexin 40 ELISA Kit
MBS019218-02 96 Well

Canine Connexin 40 ELISA Kit

Sign In for Pricing
View Details
Canine Connexin 40 ELISA Kit
MBS019218-03 5x 96 Well

Canine Connexin 40 ELISA Kit

Sign In for Pricing
View Details
Canine Connexin 40 ELISA Kit
MBS019218-04 10x 96 Well

Canine Connexin 40 ELISA Kit

Sign In for Pricing
View Details
DsRed2 Recombinant Protein
PPT-10158 100 µg

DsRed2 Recombinant Protein

Sign In for Pricing
View Details