Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse IL18 protein

This Mouse IL18 protein spans the amino acid sequence from region 1-192aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon gamma-inducing factor

UniProt

P70380

Expression Region

1-192aa

Tag

Tag-Free

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-taggedExpression Region: 1-192aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HGSNAT knockout cell line
ABC-KH6730 1 Vial

Human HGSNAT knockout cell line

Sign In for Pricing
View Details
Mouse Monoclonal SLC22A2/OCT2 Antibody (640438) [DyLight 650]
FAB6547W 0.1 mL

Mouse Monoclonal SLC22A2/OCT2 Antibody (640438) [DyLight 650]

Sign In for Pricing
View Details
Sgol2a (Sgo2a) (NM_199007) Mouse Tagged ORF Clone Lentiviral Particle
MR211732L4V 200 µL

Sgol2a (Sgo2a) (NM_199007) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Human Ubiquitin-like protein ISG15 (Isg15)
AP72087 1 mg

Recombinant Human Ubiquitin-like protein ISG15 (Isg15)

Sign In for Pricing
View Details
FAM85A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0733508 1.0 µg DNA

FAM85A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rabbit Polyclonal AcmNPV gp64 Protein Antibody [CoraFluor 1]
NBP3-26084CL1 0.1 mL

Rabbit Polyclonal AcmNPV gp64 Protein Antibody [CoraFluor 1]

Sign In for Pricing
View Details