What is the catalog number for Mouse IL18 protein?

The catalog number for Mouse IL18 protein is orb419112.

What sizes are available for Mouse IL18 protein?

Mouse IL18 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Mouse IL18 protein come in?

Mouse IL18 protein is available in 3 different pack sizes.

Is Mouse IL18 protein in stock?

Mouse IL18 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Mouse IL18 protein

This Mouse IL18 protein spans the amino acid sequence from region 1-192aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon gamma-inducing factor

UniProt

P70380

Expression Region

1-192aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: C-terminal 6xHis-taggedExpression Region: 1-192aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS