What is the catalog number for Bacterial HLGB protein?

The catalog number for Bacterial HLGB protein is orb419110.

What sizes are available for Bacterial HLGB protein?

Bacterial HLGB protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Bacterial HLGB protein come in?

Bacterial HLGB protein is available in 3 different pack sizes.

Is Bacterial HLGB protein in stock?

Bacterial HLGB protein is currently made to order / not held in immediate stock. Contact us for lead time.

Bacterial HLGB protein

This Bacterial HLGB protein spans the amino acid sequence from region 26-325aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

H-gamma-1 H-gamma-I

UniProt

P0A075

Expression Region

26-325aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Staphylococcus aureus (strain N315)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 26-325aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK