Human SLC8A1 protein
This Human SLC8A1 protein spans the amino acid sequence from region 396-627aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Na (+) /Ca (2+) -exchange protein 1 Solute carrier family 8 member 1
UniProt
P32418
Expression Region
396-627aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Homo sapiens (Human)
Field of Research
Epigenetics
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
27.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 6xHis-taggedExpression Region: 396-627aaSequence Info: Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
VNTEVTENDPVSKIFFEQGTYQCLENCGTVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGDTQKEIRVGIIDDDIFEEDENFLVHLSNVKVSSEASEDGILEANHVSTLACLGSPSTATVTIFDDDHAGIFTFEEPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQNDEIVKTISVKVIDDEEYEKNKTFFLEIG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2164548-01 0.1 mL
PE-Linked Monoclonal Antibody to Coagulation Factor XI (F11)
Sign In for Pricing
View Details MBS2164548-02 0.2 mL
PE-Linked Monoclonal Antibody to Coagulation Factor XI (F11)
Sign In for Pricing
View Details MBS2164548-03 0.5 mL
PE-Linked Monoclonal Antibody to Coagulation Factor XI (F11)
Sign In for Pricing
View Details MBS2164548-04 1 mL
PE-Linked Monoclonal Antibody to Coagulation Factor XI (F11)
Sign In for Pricing
View Details MBS2164548-05 5 mL
PE-Linked Monoclonal Antibody to Coagulation Factor XI (F11)
Sign In for Pricing
View Details