What is the catalog number for Human CHRM3 protein?

The catalog number for Human CHRM3 protein is orb419104.

What sizes are available for Human CHRM3 protein?

Human CHRM3 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human CHRM3 protein come in?

Human CHRM3 protein is available in 3 different pack sizes.

Is Human CHRM3 protein in stock?

Human CHRM3 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human CHRM3 protein

This Human CHRM3 protein spans the amino acid sequence from region 253-492aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AChR, ACM3_HUMAN, cholinergic receptor muscarinic 3, CHRM 3, CHRM3, EGBRS, HM 3, HM3, m3 muscarinic acetylcholine receptor, M3 muscarinic receptor, muscarinic 3, Muscarinic acetylcholine receptor M3, muscarinic cholinergic m3 receptor, muscarinic m3 receptor

UniProt

P20309

Expression Region

253-492aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-B2M-taggedExpression Region: 253-492aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQT