Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat HSD17B10 protein

This Rat HSD17B10 protein spans the amino acid sequence from region 2-261aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

17-beta-hydroxysteroid dehydrogenase 10

UniProt

O70351

Expression Region

2-261aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 2-261aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAAVRSVKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSEKEVQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTTLPDKVRNFLASQVPFPSRLGDPAEYAHLVQMVIENPFLNGEVIRLDGAIRMQP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RB11B ELISA Kit
E105200 1 Each

Human RB11B ELISA Kit

Sign In for Pricing
View Details
RPL13 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV714469 1.0 µg DNA

RPL13 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
KLK7 shRNA Plasmid (m)
sc-41534-SH 20 µg

KLK7 shRNA Plasmid (m)

Sign In for Pricing
View Details
Anti-Nucleosome Acidic Patch Recombinant Nanobody (1B2)
HD726023-01 50 µg

Anti-Nucleosome Acidic Patch Recombinant Nanobody (1B2)

Sign In for Pricing
View Details
Anti-Nucleosome Acidic Patch Recombinant Nanobody (1B2)
HD726023-02 100 µg

Anti-Nucleosome Acidic Patch Recombinant Nanobody (1B2)

Sign In for Pricing
View Details
Anti-Nucleosome Acidic Patch Recombinant Nanobody (1B2)
HD726023-03 1 mg

Anti-Nucleosome Acidic Patch Recombinant Nanobody (1B2)

Sign In for Pricing
View Details