What is the catalog number for Rat HSD17B10 protein?

The catalog number for Rat HSD17B10 protein is orb419101.

What sizes are available for Rat HSD17B10 protein?

Rat HSD17B10 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Rat HSD17B10 protein come in?

Rat HSD17B10 protein is available in 3 different pack sizes.

Is Rat HSD17B10 protein in stock?

Rat HSD17B10 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Rat HSD17B10 protein

This Rat HSD17B10 protein spans the amino acid sequence from region 2-261aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

17-beta-hydroxysteroid dehydrogenase 10

UniProt

O70351

Expression Region

2-261aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 2-261aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAAVRSVKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSEKEVQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTTLPDKVRNFLASQVPFPSRLGDPAEYAHLVQMVIENPFLNGEVIRLDGAIRMQP